Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Onecut3 Peptide - C-terminal region

Onecut3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OC-3, Oc3

UniProt

Q8K557

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Onecut3 Rabbit Polyclonal Antibody (orb576321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631972

Preservative

Lyophilized powder

AA Sequence

QEPEFQRMSALRLAACKRKEQDQQKERALQPKKQRLVFTDLQRRTLIAIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Spink4 activation kit by CRISPRa
GA204073 1 Kit

Mouse Spink4 activation kit by CRISPRa

Sign In for Pricing
View Details
MLKL Polyclonal Antibody
UB-GEN-14622 100 µL

MLKL Polyclonal Antibody

Sign In for Pricing
View Details
Plekha6 Peptide - middle region (AAP42426)
AAP42426-100UG 100 µg

Plekha6 Peptide - middle region (AAP42426)

Sign In for Pricing
View Details
ApoB Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-61417R-PerCP-Cy5.5 100 µL

ApoB Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
AA415398 (BC076608) Mouse Untagged Clone
MC206199 10 µg

AA415398 (BC076608) Mouse Untagged Clone

Sign In for Pricing
View Details
OR4N2 Antibody
56-315 400 µL

OR4N2 Antibody

Sign In for Pricing
View Details