Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPA3 Peptide - C-terminal region

OPA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22187, FLJ25932, MGA3, MGC75494

UniProt

Q9H6K4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPA3 Rabbit Polyclonal Antibody (orb584465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017989

Preservative

Lyophilized powder

AA Sequence

STTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD405 NHS Ester
1804-AAT 1 mg

XFD405 NHS Ester

Sign In for Pricing
View Details
N-Acetyl-3-hydroxyindole
TRC-A178950-500MG 500 mg

N-Acetyl-3-hydroxyindole

Sign In for Pricing
View Details
Carfentrazone Ethyl-d5
TRC-C183456-5MG 5 mg

Carfentrazone Ethyl-d5

Sign In for Pricing
View Details
LY75 Antibody
OC-610-01 50 μL

LY75 Antibody

Sign In for Pricing
View Details
LY75 Antibody
OC-610-02 100 µL

LY75 Antibody

Sign In for Pricing
View Details
LY75 Antibody
OC-610-03 1 mL

LY75 Antibody

Sign In for Pricing
View Details