Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPA3 Peptide - C-terminal region

OPA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22187, FLJ25932, MGA3, MGC75494

UniProt

Q9H6K4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPA3 Rabbit Polyclonal Antibody (orb584465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017989

Preservative

Lyophilized powder

AA Sequence

STTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P4HA3 Human Gene Knockout Kit (CRISPR)
KN424487 1 Kit

P4HA3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCLT1 Human Gene Knockout Kit (CRISPR)
KN418526 1 Kit

SCLT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Allium sativum Lectin (Garlic) -ASA-,  30nm
GP-8007-30 1 mL

Colloidal Gold Conjugated Allium sativum Lectin (Garlic) -ASA-, 30nm

Sign In for Pricing
View Details
STCH (HSPA13) Rabbit Polyclonal Antibody
TA360788 100 µL

STCH (HSPA13) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF568 conjugate, 0.1mg/mL
BNC681805-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706150 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details