Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN1MW Peptide - C-terminal region

OPN1MW Peptide - C-terminal region

Product Specifications

Product Name Alternative

CBBM, CBD, GCP, MGC176615, MGC177321, MGC198468, MGC198469, OPN1MW1, OPN1MW2, GOP, COD5

UniProt

P04000

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPN1MW Rabbit Polyclonal Antibody (orb584445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000504

Preservative

Lyophilized powder

AA Sequence

SATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR1H3 Polyclonal Antibody, FITC Conjugated
A55345-050 50 µL

NR1H3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
C11orf83 Protein Vector (Human) (pPM-C-His)
PV065432 500 ng

C11orf83 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Pseudomonas aeruginosa Inner Core Antibody
orb359318 100 µg

Pseudomonas aeruginosa Inner Core Antibody

Sign In for Pricing
View Details
NFKB2, Phosphorylated (S866) (Nuclear Factor kappa B, p52, p105, H2TF1, LYT10, CVID10, LYT-10, NF-kB2) (PE)
MBS6429025-01 0.1 mL

NFKB2, Phosphorylated (S866) (Nuclear Factor kappa B, p52, p105, H2TF1, LYT10, CVID10, LYT-10, NF-kB2) (PE)

Sign In for Pricing
View Details
NFKB2, Phosphorylated (S866) (Nuclear Factor kappa B, p52, p105, H2TF1, LYT10, CVID10, LYT-10, NF-kB2) (PE)
MBS6429025-02 5x 0.1 mL

NFKB2, Phosphorylated (S866) (Nuclear Factor kappa B, p52, p105, H2TF1, LYT10, CVID10, LYT-10, NF-kB2) (PE)

Sign In for Pricing
View Details
FHL-3 siRNA (h)
sc-37893 10 µM

FHL-3 siRNA (h)

Sign In for Pricing
View Details