Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN1MW Peptide - C-terminal region

OPN1MW Peptide - C-terminal region

Product Specifications

Product Name Alternative

CBBM, CBD, GCP, MGC176615, MGC177321, MGC198468, MGC198469, OPN1MW1, OPN1MW2, GOP, COD5

UniProt

P04000

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPN1MW Rabbit Polyclonal Antibody (orb584445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000504

Preservative

Lyophilized powder

AA Sequence

SATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA3 Rabbit Polyclonal Antibody (HRP)
orb469699 100 µL

GATA3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Monoclonal SOX10 Antibody (SOX10/2311R) - Azide and BSA Free
NBP2-79905 100 µg

Rabbit Monoclonal SOX10 Antibody (SOX10/2311R) - Azide and BSA Free

Sign In for Pricing
View Details
Ankyrin repeat domain-containing protein 46 (ANKRD46) Mouse ELISA Kit
B5235 96 Tests

Ankyrin repeat domain-containing protein 46 (ANKRD46) Mouse ELISA Kit

Sign In for Pricing
View Details
Calcium Sensing Receptor (Calcium-sensing Receptor, CASR, CAR, EIG8, Extracellular Calcium-sensing Receptor, FHH, FIH, GPRC2A, HHC, HHC1, MGC138441, NSHPT, Parathyroid Cell Calcium-sensing Receptor, PCaR1) (MaxLight 490)
124251-ML490 100 µL

Calcium Sensing Receptor (Calcium-sensing Receptor, CASR, CAR, EIG8, Extracellular Calcium-sensing Receptor, FHH, FIH, GPRC2A, HHC, HHC1, MGC138441, NSHPT, Parathyroid Cell Calcium-sensing Receptor, PCaR1) (MaxLight 490)

Sign In for Pricing
View Details
Heat Shock Protein 27, phosphorylated (Ser78) (HSP27) (MaxLight 750) discontinued
H1830-52-ML750 100 µL

Heat Shock Protein 27, phosphorylated (Ser78) (HSP27) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Tada2a (NM_172562) Mouse Tagged Lenti ORF Clone
MR207073L3 10 µg

Tada2a (NM_172562) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details