Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN3 Peptide - C-terminal region

OPN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ECPN

UniProt

Q9H1Y3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPN3 Rabbit Polyclonal Antibody (orb584457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055137

Preservative

Lyophilized powder

AA Sequence

IVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trofosfamide
TRC-T892000-250MG 250 mg

Trofosfamide

Sign In for Pricing
View Details
Ranbp10 Mouse Gene Knockout Kit (CRISPR)
KN514455 1 Kit

Ranbp10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ICAM1 Antibody
KC-6280-01 50 μL

ICAM1 Antibody

Sign In for Pricing
View Details
ICAM1 Antibody
KC-6280-02 100 µL

ICAM1 Antibody

Sign In for Pricing
View Details
ICAM1 Antibody
KC-6280-03 1 mL

ICAM1 Antibody

Sign In for Pricing
View Details
FAM200B Human Gene Knockout Kit (CRISPR)
KN427138 1 Kit

FAM200B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details