Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN3 Peptide - C-terminal region

OPN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ECPN

UniProt

Q9H1Y3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPN3 Rabbit Polyclonal Antibody (orb584457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055137

Preservative

Lyophilized powder

AA Sequence

IVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxin Sulfoxide
TRC-C177605-50MG 50 mg

Carboxin Sulfoxide

Sign In for Pricing
View Details
Slc12a5 Mouse Monoclonal Antibody [Clone ID: N1/66]
75-050 100 µL

Slc12a5 Mouse Monoclonal Antibody [Clone ID: N1/66]

Sign In for Pricing
View Details
PX-2
TRC-P840798-50MG 50 mg

PX-2

Sign In for Pricing
View Details
LINC01356 Antibody
KC-32429-01 50 μL

LINC01356 Antibody

Sign In for Pricing
View Details
LINC01356 Antibody
KC-32429-02 100 µL

LINC01356 Antibody

Sign In for Pricing
View Details
LINC01356 Antibody
KC-32429-03 1 mL

LINC01356 Antibody

Sign In for Pricing
View Details