Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN5 Peptide - C-terminal region

OPN5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NEUROPSIN, PGR12, TMEM13, GPR136

UniProt

Q6U736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPN5 Rabbit Polyclonal Antibody (orb584474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859528

Preservative

Lyophilized powder

AA Sequence

FFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cdh20 ELISA Kit
ELI-11133r 96 Tests

Rat Cdh20 ELISA Kit

Sign In for Pricing
View Details
COMMD1 Antibody
A61419-100UG 100 µg

COMMD1 Antibody

Sign In for Pricing
View Details
Rat soluble Interleukin 2 Receptor Alpha (sIL-2Rα) ELISA kit
EIA05879r 1 Kit

Rat soluble Interleukin 2 Receptor Alpha (sIL-2Rα) ELISA kit

Sign In for Pricing
View Details
Mouse Monoclonal POLR2E Antibody (OTI3B5) [DyLight 350]
NBP2-73518UV 0.1 mL

Mouse Monoclonal POLR2E Antibody (OTI3B5) [DyLight 350]

Sign In for Pricing
View Details
Human Recoverin Recombinant Protein
PROTP35243-01 20 µg

Human Recoverin Recombinant Protein

Sign In for Pricing
View Details
Human Recoverin Recombinant Protein
PROTP35243-02 500 µg

Human Recoverin Recombinant Protein

Sign In for Pricing
View Details