Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1D2 Peptide - C-terminal region

OR1D2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119942, MGC119943, OLFR1, OR17-4

UniProt

P34982

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1D2 Rabbit Polyclonal Antibody (orb584417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002539

Preservative

Lyophilized powder

AA Sequence

RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound Fr16609
Fr16609-01 200 mg

Compound Fr16609

Sign In for Pricing
View Details
Compound Fr16609
Fr16609-02 10 mg

Compound Fr16609

Sign In for Pricing
View Details
Compound Fr16609
Fr16609-03 50 mg

Compound Fr16609

Sign In for Pricing
View Details
Human ABHD14B (NM_032750) AAV Particle
RC203520A1V 250 µL

Human ABHD14B (NM_032750) AAV Particle

Sign In for Pricing
View Details
RPUSD3 CRISPR Knock Out 293T Cell Line (Human)
42727141 1x 10^6 Cells / 1.0 mL

RPUSD3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
LGR5 Antibody
A76090-50UL 50 μL

LGR5 Antibody

Sign In for Pricing
View Details