Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1D2 Peptide - C-terminal region

OR1D2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119942, MGC119943, OLFR1, OR17-4

UniProt

P34982

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1D2 Rabbit Polyclonal Antibody (orb584417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002539

Preservative

Lyophilized powder

AA Sequence

RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creatine kinase B type (CKB) (NM_001823) Human Over-expression Lysate
E45H19652-2 20 µg

Creatine kinase B type (CKB) (NM_001823) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal MOS Antibody (S3.1) [Alexa Fluor 594]
NB100-2784AF594 0.1 mL

Mouse Monoclonal MOS Antibody (S3.1) [Alexa Fluor 594]

Sign In for Pricing
View Details
IGHV3OR16-15 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV729607 1.0 µg DNA

IGHV3OR16-15 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CA XI Polyclonal Antibody
MBS9238512-01 0.1 mL

CA XI Polyclonal Antibody

Sign In for Pricing
View Details
CA XI Polyclonal Antibody
MBS9238512-02 5x 0.1 mL

CA XI Polyclonal Antibody

Sign In for Pricing
View Details
TUSC1 CRISPR Activation Plasmid (m2)
sc-427310-ACT-2 20 µg

TUSC1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details