Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1G1 Peptide - C-terminal region

OR1G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR17-130, OR17-209, OR1G2

UniProt

P47890

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1G1 Rabbit Polyclonal Antibody (orb326302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003546

Preservative

Lyophilized powder

AA Sequence

FDDLYRISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS24 (CHMP3) (NM_016079) Human Recombinant Protein
TP320006M 100 µg

VPS24 (CHMP3) (NM_016079) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant CD38 Antibody
RC-7082-01 50 μL

Recombinant CD38 Antibody

Sign In for Pricing
View Details
Recombinant CD38 Antibody
RC-7082-02 100 µL

Recombinant CD38 Antibody

Sign In for Pricing
View Details
Recombinant CD38 Antibody
RC-7082-03 1 mL

Recombinant CD38 Antibody

Sign In for Pricing
View Details
rac 1-Palmitoyl-3-chloropropanediol
TRC-P156500-50MG 50 mg

rac 1-Palmitoyl-3-chloropropanediol

Sign In for Pricing
View Details
Recombinant Human IgG2-Fc Protein
PKSH033653-01 10 µg

Recombinant Human IgG2-Fc Protein

Sign In for Pricing
View Details