Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1G1 Peptide - C-terminal region

OR1G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR17-130, OR17-209, OR1G2

UniProt

P47890

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1G1 Rabbit Polyclonal Antibody (orb326302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003546

Preservative

Lyophilized powder

AA Sequence

FDDLYRISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD62L Antibody[HI62L]
E-AB-F1336D-01 20 Tests

PE Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
PE Anti-Human CD62L Antibody[HI62L]
E-AB-F1336D-02 100 Tests

PE Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
PE Anti-Human CD62L Antibody[HI62L]
E-AB-F1336D-03 2x 100 Tests

PE Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
Ketohexokinase Recombinant Rabbit monoclonal Antibody
HA750860 100 µL

Ketohexokinase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Myoglobin (Muscle Cell Marker) (rMB/2105), CF740 conjugate, 0.1mg/mL
BNC743800-500 1x 500 µL

Myoglobin (Muscle Cell Marker) (rMB/2105), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OB Cadherin (CDH11) Goat Polyclonal Antibody
AB0139-100 300 µg

OB Cadherin (CDH11) Goat Polyclonal Antibody

Sign In for Pricing
View Details