Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1J1 Peptide - C-terminal region

OR1J1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR9-18, hg32

UniProt

Q8NGS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1J1 Rabbit Polyclonal Antibody (orb326304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004451

Preservative

Lyophilized powder

AA Sequence

TKGICKALSTCGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0549807 1.0 µg DNA

CYP2A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Matrix Metalloproteinase 9 (MMP9) Blocking Peptide
abx062947-01 1 mg

Matrix Metalloproteinase 9 (MMP9) Blocking Peptide

Sign In for Pricing
View Details
Matrix Metalloproteinase 9 (MMP9) Blocking Peptide
abx062947-02 5 mg

Matrix Metalloproteinase 9 (MMP9) Blocking Peptide

Sign In for Pricing
View Details
Dedd ORF Vector (Mouse) (pORF)
17873014 1.0 µg DNA

Dedd ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
0610040J01Rik Protein Vector (Mouse) (pPM-C-HA)
PV146220 500 ng

0610040J01Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Fluoroglycofen-ethyl
450207-01 100 mg

Fluoroglycofen-ethyl

Sign In for Pricing
View Details