Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1J1 Peptide - C-terminal region

OR1J1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR9-18, hg32

UniProt

Q8NGS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1J1 Rabbit Polyclonal Antibody (orb326304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004451

Preservative

Lyophilized powder

AA Sequence

TKGICKALSTCGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PRAMEF20/21 Antibody
MBS8307773-01 0.03 mL

Anti-PRAMEF20/21 Antibody

Sign In for Pricing
View Details
Anti-PRAMEF20/21 Antibody
MBS8307773-02 0.05 mL

Anti-PRAMEF20/21 Antibody

Sign In for Pricing
View Details
Anti-PRAMEF20/21 Antibody
MBS8307773-03 0.1 mL

Anti-PRAMEF20/21 Antibody

Sign In for Pricing
View Details
Anti-PRAMEF20/21 Antibody
MBS8307773-04 0.2 mL

Anti-PRAMEF20/21 Antibody

Sign In for Pricing
View Details
Anti-PRAMEF20/21 Antibody
MBS8307773-05 5x 0.2 mL

Anti-PRAMEF20/21 Antibody

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Interleukin 6 Receptor (IL6R)
MBS2059477-01 0.1 mL

APC-Linked Polyclonal Antibody to Interleukin 6 Receptor (IL6R)

Sign In for Pricing
View Details