Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1S1 Peptide - C-terminal region

OR1S1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-232, OST034

UniProt

Q8NH92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1S1 Rabbit Polyclonal Antibody (orb326307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004458

Preservative

Lyophilized powder

AA Sequence

FSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CEA Matched Antibody Pair Set [IV0445/RD0429]
Z01LS-0423-LS76 5 Plates

Human CEA Matched Antibody Pair Set [IV0445/RD0429]

Sign In for Pricing
View Details
Mouse Anti Hepatitis C E2 Antigen Monoclonal Antibody
DMABT-51334MH 0.1 mg

Mouse Anti Hepatitis C E2 Antigen Monoclonal Antibody

Sign In for Pricing
View Details
PPM1F (NM_014634) Human Over-expression Lysate
LC402357 20 µg

PPM1F (NM_014634) Human Over-expression Lysate

Sign In for Pricing
View Details
Adenosine A1 Receptor (ADORA1) Antibody (Biotin)
abx303014-01 20 µg

Adenosine A1 Receptor (ADORA1) Antibody (Biotin)

Sign In for Pricing
View Details
Adenosine A1 Receptor (ADORA1) Antibody (Biotin)
abx303014-02 50 µg

Adenosine A1 Receptor (ADORA1) Antibody (Biotin)

Sign In for Pricing
View Details
Adenosine A1 Receptor (ADORA1) Antibody (Biotin)
abx303014-03 100 µg

Adenosine A1 Receptor (ADORA1) Antibody (Biotin)

Sign In for Pricing
View Details