Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1S1 Peptide - C-terminal region

OR1S1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-232, OST034

UniProt

Q8NH92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1S1 Rabbit Polyclonal Antibody (orb326307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004458

Preservative

Lyophilized powder

AA Sequence

FSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT13, NT (SYT13, KIAA1427, Synaptotagmin-13, Synaptotagmin XIII) (FITC)
MBS6352976-01 0.2 mL

SYT13, NT (SYT13, KIAA1427, Synaptotagmin-13, Synaptotagmin XIII) (FITC)

Sign In for Pricing
View Details
SYT13, NT (SYT13, KIAA1427, Synaptotagmin-13, Synaptotagmin XIII) (FITC)
MBS6352976-02 5x 0.2 mL

SYT13, NT (SYT13, KIAA1427, Synaptotagmin-13, Synaptotagmin XIII) (FITC)

Sign In for Pricing
View Details
Goat anti-biotinidase (aa372-385) Antibody
dAP-2790 50 µg

Goat anti-biotinidase (aa372-385) Antibody

Sign In for Pricing
View Details
Plasma/Serum cfc-DNA Advanced Purification Kit
68000 50 Preparations

Plasma/Serum cfc-DNA Advanced Purification Kit

Sign In for Pricing
View Details
Mitochondrial Marker (MTC02), CF647 conjugate, 0.1mg/mL
BNC470740-500 1x 500 µL

Mitochondrial Marker (MTC02), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
H-D-Leu-leu-oh
451593-01 25 mg

H-D-Leu-leu-oh

Sign In for Pricing
View Details