Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A5 Peptide - C-terminal region

OR2A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2A11P, OR2A26, OR2A8, OR7-138, OR7-141

UniProt

Q96R48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2A5 Rabbit Polyclonal Antibody (orb584419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036497

Preservative

Lyophilized powder

AA Sequence

LHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Histone Deacetylase 1 (HDAC1) ELISA Kit
RD-HDAC1-Hu-96Tests 96 Tests

Human Histone Deacetylase 1 (HDAC1) ELISA Kit

Sign In for Pricing
View Details
MAGEA8 Antibody
MBS7125921-01 0.05 mL

MAGEA8 Antibody

Sign In for Pricing
View Details
MAGEA8 Antibody
MBS7125921-02 0.1 mL

MAGEA8 Antibody

Sign In for Pricing
View Details
MAGEA8 Antibody
MBS7125921-03 5x 0.1 mL

MAGEA8 Antibody

Sign In for Pricing
View Details
JAG2 Knockout MCF7 Polyclonal Cells
ARG36460 1 Million

JAG2 Knockout MCF7 Polyclonal Cells

Sign In for Pricing
View Details
Human α1BG ELISA Kit
E111046 1 Each

Human α1BG ELISA Kit

Sign In for Pricing
View Details