Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A5 Peptide - C-terminal region

OR2A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2A11P, OR2A26, OR2A8, OR7-138, OR7-141

UniProt

Q96R48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2A5 Rabbit Polyclonal Antibody (orb584419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036497

Preservative

Lyophilized powder

AA Sequence

LHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-USP8 Antibody, Affinity Purified
A302-929A-T 2 µg

Rabbit anti-USP8 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit Anti-Rat IgG H&L (TRITC), 1 pack = 100 µLx10
BAL6209 1 Each

Rabbit Anti-Rat IgG H&L (TRITC), 1 pack = 100 µLx10

Sign In for Pricing
View Details
HuD (H-9) Alexa Fluor® 594
sc-48421 AF594 200 µg/mL

HuD (H-9) Alexa Fluor® 594

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Antibody
abx100483-01 100 µL

Cyclin D1 (CCND1) Antibody

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Antibody
abx100483-02 200 µL

Cyclin D1 (CCND1) Antibody

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Antibody
abx100483-03 1 mL

Cyclin D1 (CCND1) Antibody

Sign In for Pricing
View Details