Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2AT4 Peptide - N-terminal region

OR2AT4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OR11-265

UniProt

A6NND4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2AT4 Rabbit Polyclonal Antibody (orb579190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005285

Preservative

Lyophilized powder

AA Sequence

MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB8 Mouse Monoclonal Antibody [Clone ID: OTI7D2]
CF808403 100 µg

ASB8 Mouse Monoclonal Antibody [Clone ID: OTI7D2]

Sign In for Pricing
View Details
TOB1 (Ab-164) Antibody
8B8438-AAT 50 µg

TOB1 (Ab-164) Antibody

Sign In for Pricing
View Details
Cxcl5 Mouse Gene Knockout Kit (CRISPR)
KN304047 1 Kit

Cxcl5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glutathione S-Transferase Mu2 (GSTM2) (CPTC-GSTMu2-2), CF405S conjugate, 0.1mg/mL
BNC042242-500 1x 500 µL

Glutathione S-Transferase Mu2 (GSTM2) (CPTC-GSTMu2-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fas Ligand (FASLG) Human Gene Knockout Kit (CRISPR)
KN204894LP 1 Kit

Fas Ligand (FASLG) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PerCP Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331UF-01 25 µg

PerCP Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details