Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2AT4 Peptide - N-terminal region

OR2AT4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OR11-265

UniProt

A6NND4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2AT4 Rabbit Polyclonal Antibody (orb579190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005285

Preservative

Lyophilized powder

AA Sequence

MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMPRSS13 activation kit by CRISPRa
GA113336 1 Kit

Human TMPRSS13 activation kit by CRISPRa

Sign In for Pricing
View Details
Activin Receptor Type IIA (ACVR2A) Mouse Monoclonal Antibody [Clone ID: OTI8C7]
CF807401 100 µg

Activin Receptor Type IIA (ACVR2A) Mouse Monoclonal Antibody [Clone ID: OTI8C7]

Sign In for Pricing
View Details
Bromazine-d6 Hydrochloride
TRC-B678527-5MG 5 mg

Bromazine-d6 Hydrochloride

Sign In for Pricing
View Details
2-(4-Chlorophenyl)ethylamine
TRC-C377640-5G 5 g

2-(4-Chlorophenyl)ethylamine

Sign In for Pricing
View Details
FAK (PTK2) Mouse Monoclonal Antibody [Clone ID: 10H7]
AM06508SU-N 100 µL

FAK (PTK2) Mouse Monoclonal Antibody [Clone ID: 10H7]

Sign In for Pricing
View Details
Human Advillin (AVIL) activation kit by CRISPRa
GA107322 1 Kit

Human Advillin (AVIL) activation kit by CRISPRa

Sign In for Pricing
View Details