Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2B2 Peptide - C-terminal region

OR2B2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2B2Q, OR2B9, OR6-1, dJ193B12.4, hs6M1-10

UniProt

Q9GZK3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2B2 Rabbit Polyclonal Antibody (orb584421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149046

Preservative

Lyophilized powder

AA Sequence

IAPMLNPLIYTLRNKEVKEAFKRLVAKSLLNQEIRNMQMISFAKDTVLTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TECPR2 Protein Lysate
OCOA21258-20UG 20 µg

TECPR2 Protein Lysate

Sign In for Pricing
View Details
Ruthenium Red 99% For Microscopy
226600001 1 mg

Ruthenium Red 99% For Microscopy

Sign In for Pricing
View Details
CC50A Polyclonal Antibody
ABP58003-01 30 µL

CC50A Polyclonal Antibody

Sign In for Pricing
View Details
CC50A Polyclonal Antibody
ABP58003-02 100 µL

CC50A Polyclonal Antibody

Sign In for Pricing
View Details
CC50A Polyclonal Antibody
ABP58003-03 200 µL

CC50A Polyclonal Antibody

Sign In for Pricing
View Details
Mdh1b (NM_001108221) Rat Tagged Lenti ORF Clone
RR206081L4 10 µg

Mdh1b (NM_001108221) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details