Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2B2 Peptide - C-terminal region

OR2B2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2B2Q, OR2B9, OR6-1, dJ193B12.4, hs6M1-10

UniProt

Q9GZK3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2B2 Rabbit Polyclonal Antibody (orb584421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149046

Preservative

Lyophilized powder

AA Sequence

IAPMLNPLIYTLRNKEVKEAFKRLVAKSLLNQEIRNMQMISFAKDTVLTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG, Porcine (HRP)
MBS654934-01 1 mg

IgG, Porcine (HRP)

Sign In for Pricing
View Details
IgG, Porcine (HRP)
MBS654934-02 5x 1 mg

IgG, Porcine (HRP)

Sign In for Pricing
View Details
Human TSPAN10 Knockout A549 cell line
GTR15414029 1 Vial

Human TSPAN10 Knockout A549 cell line

Sign In for Pricing
View Details
Nabertherm Chamber Furnce LF15/13 - EACH
FUR2184 1 Each

Nabertherm Chamber Furnce LF15/13 - EACH

Sign In for Pricing
View Details
PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: LBI24D2]
AMM18118V 100 µL

PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: LBI24D2]

Sign In for Pricing
View Details
LRP5L (NM_001135772) Human Recombinant Protein
TP760928 50 µg

LRP5L (NM_001135772) Human Recombinant Protein

Sign In for Pricing
View Details