Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2C3 Peptide - C-terminal region

OR2C3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2C4, OR2C5P, OST742

UniProt

Q8N628

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2C3 Rabbit Polyclonal Antibody (orb584423) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_932340

Preservative

Lyophilized powder

AA Sequence

LFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFViolet 450 Anti-Human/Mouse/Rat CD47 Antibody
RD30143F-01 20 Tests

AFViolet 450 Anti-Human/Mouse/Rat CD47 Antibody

Sign In for Pricing
View Details
AFViolet 450 Anti-Human/Mouse/Rat CD47 Antibody
RD30143F-02 100 Tests

AFViolet 450 Anti-Human/Mouse/Rat CD47 Antibody

Sign In for Pricing
View Details
AFViolet 450 Anti-Human/Mouse/Rat CD47 Antibody
RD30143F-03 2x 100 Tests

AFViolet 450 Anti-Human/Mouse/Rat CD47 Antibody

Sign In for Pricing
View Details
AZD2014 10mg
A11303-10 10 mg

AZD2014 10mg

Sign In for Pricing
View Details
LMP2 Polyclonal Antibody, RBITC Conjugated
bs-2787R-RBITC 100 µL

LMP2 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PXDC1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV773476 1.0 µg DNA

PXDC1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details