Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2H2 Peptide - C-terminal region

OR2H2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAT11, MGC126732, MGC138381, OLFR2, OLFR42B, OR2H3, dJ271M21.2, hs6M1-12

UniProt

O95918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2H2 Rabbit Polyclonal Antibody (orb584427) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009091

Preservative

Lyophilized powder

AA Sequence

SLILVSYGAITWAVLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At3g08810 Polyclonal Antibody
MBS9009062 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At3g08810 Polyclonal Antibody

Sign In for Pricing
View Details
Aflatoxin P1
MBS6099351-01 0.5 mg

Aflatoxin P1

Sign In for Pricing
View Details
Aflatoxin P1
MBS6099351-02 5x 0.5 mg

Aflatoxin P1

Sign In for Pricing
View Details
Volumetric Sol Sodium Hydroxide 1.666M (1.666N) - 1L
S216661 1 L

Volumetric Sol Sodium Hydroxide 1.666M (1.666N) - 1L

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis D-alanine--D-alanine ligase (ddl)
MBS1129361-01 0.02 mg (E-Coli)

Recombinant Erwinia tasmaniensis D-alanine--D-alanine ligase (ddl)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis D-alanine--D-alanine ligase (ddl)
MBS1129361-02 0.02 mg (Yeast)

Recombinant Erwinia tasmaniensis D-alanine--D-alanine ligase (ddl)

Sign In for Pricing
View Details