Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2H2 Peptide - C-terminal region

OR2H2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAT11, MGC126732, MGC138381, OLFR2, OLFR42B, OR2H3, dJ271M21.2, hs6M1-12

UniProt

O95918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2H2 Rabbit Polyclonal Antibody (orb584427) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009091

Preservative

Lyophilized powder

AA Sequence

SLILVSYGAITWAVLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp592 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV639473 1.0 µg DNA

Zfp592 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial
orb1095976-01 20 µg

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial

Sign In for Pricing
View Details
Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial
orb1095976-02 100 µg

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial

Sign In for Pricing
View Details
Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial
orb1095976-03 1 mg

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial

Sign In for Pricing
View Details
ITSN2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1108503 1.0 µg DNA

ITSN2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Goat Phospho MEK1 (T286) Antibody
orb1524511-01 10 µL

Goat Phospho MEK1 (T286) Antibody

Sign In for Pricing
View Details