Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2J2 Peptide - C-terminal region

OR2J2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119134, MGC119135, MGC119136, MGC119137, OR6-19, OR6-8, OR6.3.8, ORL684, dJ80I19.4, hs6M1-6

UniProt

O76002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2J2 Rabbit Polyclonal Antibody (orb584429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112167

Preservative

Lyophilized powder

AA Sequence

ILAAILRIQSGEGRRKAFSTCSSHLCMVGLFFGSAIVMYMAPKSRHPEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA6 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61614R-BF594-TR 20 µL

GATA6 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
TIGIT Recombinant Protein (Human)
RP044146 100 µg

TIGIT Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal IFN-alpha B2/IFN-alpha 8 Antibody (003) [DyLight 680]
NBP2-89440FR 0.1 mL

Rabbit Monoclonal IFN-alpha B2/IFN-alpha 8 Antibody (003) [DyLight 680]

Sign In for Pricing
View Details
Stabilin-1 (h) -PR
sc-45784-PR 10 µM - 20 µL

Stabilin-1 (h) -PR

Sign In for Pricing
View Details
C1orf105 shRNA (h) Lentiviral Particles
sc-78835-V 200 µL

C1orf105 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-500-3p Vector
mm30826 500 ng

LentimiRa-Off-mmu-miR-500-3p Vector

Sign In for Pricing
View Details