Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2J2 Peptide - C-terminal region

OR2J2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119134, MGC119135, MGC119136, MGC119137, OR6-19, OR6-8, OR6.3.8, ORL684, dJ80I19.4, hs6M1-6

UniProt

O76002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2J2 Rabbit Polyclonal Antibody (orb584429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112167

Preservative

Lyophilized powder

AA Sequence

ILAAILRIQSGEGRRKAFSTCSSHLCMVGLFFGSAIVMYMAPKSRHPEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf38 (NM_144970) Human Recombinant Protein
TP306880L 1 mg

CXorf38 (NM_144970) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Zebrafish vwf Antibody-FITC Conjugate
DZ00270-FITC 200 µL/Vial

Anti-Zebrafish vwf Antibody-FITC Conjugate

Sign In for Pricing
View Details
Anti-IVNS1ABP Antibody Picoband® Fluoro550 Conjugated
A10942-2-Fluoro550 100 µg/Vial

Anti-IVNS1ABP Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Swinepox virus One-Step PCR kit
Oneq-V727-150D 150 Reactions

Swinepox virus One-Step PCR kit

Sign In for Pricing
View Details
MAP2K5 (Mitogen-Activated Protein Kinase Kinase 5, HsT17454, MAPKK5, MEK5, PRKMK5) (PE)
248441-PE 100 µL

MAP2K5 (Mitogen-Activated Protein Kinase Kinase 5, HsT17454, MAPKK5, MEK5, PRKMK5) (PE)

Sign In for Pricing
View Details
NADH-cytochrome b5 reductase 2
orb1638817-01 50 µg

NADH-cytochrome b5 reductase 2

Sign In for Pricing
View Details