Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2J2 Peptide - C-terminal region

OR2J2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119134, MGC119135, MGC119136, MGC119137, OR6-19, OR6-8, OR6.3.8, ORL684, dJ80I19.4, hs6M1-6

UniProt

O76002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2J2 Rabbit Polyclonal Antibody (orb584430) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112167

Preservative

Lyophilized powder

AA Sequence

VMCMYLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKGAAKRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PAX3 Antibody
CQA2135-01 30 µL

Anti-PAX3 Antibody

Sign In for Pricing
View Details
Anti-PAX3 Antibody
CQA2135-02 50 μL

Anti-PAX3 Antibody

Sign In for Pricing
View Details
Anti-PAX3 Antibody
CQA2135-03 100 µL

Anti-PAX3 Antibody

Sign In for Pricing
View Details
Anti-PAX3 Antibody
CQA2135-04 200 µL

Anti-PAX3 Antibody

Sign In for Pricing
View Details
Clerodenoside A
PGA02275-01 5 mg

Clerodenoside A

Sign In for Pricing
View Details
Clerodenoside A
PGA02275-02 10 mg

Clerodenoside A

Sign In for Pricing
View Details