Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2L8 Peptide - C-terminal region

OR2L8 Peptide - C-terminal region

Product Specifications

UniProt

Q8NGY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2L8 Rabbit Polyclonal Antibody (orb584432) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001963

Preservative

Lyophilized powder

AA Sequence

TYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGALTRVSQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 zeta (14-3-3 Protein zeta/delta, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAZ) (MaxLight 750)
MBS6236159-01 0.1 mL

14-3-3 zeta (14-3-3 Protein zeta/delta, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAZ) (MaxLight 750)

Sign In for Pricing
View Details
14-3-3 zeta (14-3-3 Protein zeta/delta, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAZ) (MaxLight 750)
MBS6236159-02 5x 0.1 mL

14-3-3 zeta (14-3-3 Protein zeta/delta, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAZ) (MaxLight 750)

Sign In for Pricing
View Details
Canine Follicle stimulating hormone receptor (FSHR) ELISA kit
GTR10459499 96 Well

Canine Follicle stimulating hormone receptor (FSHR) ELISA kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 21 (FGF21) CLIA Kit
abx190198-01 96 Tests

Human Fibroblast Growth Factor 21 (FGF21) CLIA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 21 (FGF21) CLIA Kit
abx190198-02 5x 96 Tests

Human Fibroblast Growth Factor 21 (FGF21) CLIA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 21 (FGF21) CLIA Kit
abx190198-03 10x 96 Tests

Human Fibroblast Growth Factor 21 (FGF21) CLIA Kit

Sign In for Pricing
View Details