Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2L8 Peptide - C-terminal region

OR2L8 Peptide - C-terminal region

Product Specifications

UniProt

Q8NGY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2L8 Rabbit Polyclonal Antibody (orb584432) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001963

Preservative

Lyophilized powder

AA Sequence

TYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGALTRVSQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ksr1 3'UTR Luciferase Stable Cell Line
TU206905 1.0 mL

Ksr1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Afg3l2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4358002 1.0 µg DNA

Afg3l2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Anti-STAT1 Antibody (Monoclonal, 12C7)
MBS1752782-01 0.01 mg

Anti-STAT1 Antibody (Monoclonal, 12C7)

Sign In for Pricing
View Details
Anti-STAT1 Antibody (Monoclonal, 12C7)
MBS1752782-02 0.1 mg (Carrier Free)

Anti-STAT1 Antibody (Monoclonal, 12C7)

Sign In for Pricing
View Details
Anti-STAT1 Antibody (Monoclonal, 12C7)
MBS1752782-03 0.1 mg

Anti-STAT1 Antibody (Monoclonal, 12C7)

Sign In for Pricing
View Details
Anti-STAT1 Antibody (Monoclonal, 12C7)
MBS1752782-04 0.1 mg (Cy3)

Anti-STAT1 Antibody (Monoclonal, 12C7)

Sign In for Pricing
View Details