Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2M2 Peptide - C-terminal region

OR2M2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2M2Q, OST423

UniProt

Q96R28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2M2 Rabbit Polyclonal Antibody (orb584434) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004688

Preservative

Lyophilized powder

AA Sequence

FTTCSSHLMVVGMYYGAALFMYIRPTSDHSPTQDKMVSVFYTILTPMLNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mfsd6 Mouse siRNA Oligo Duplex (Locus ID 98682)
SR426881 1 Kit

Mfsd6 Mouse siRNA Oligo Duplex (Locus ID 98682)

Sign In for Pricing
View Details
Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)
MBS2169403-01 0.1 mL

Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)

Sign In for Pricing
View Details
Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)
MBS2169403-02 0.2 mL

Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)

Sign In for Pricing
View Details
Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)
MBS2169403-03 0.5 mL

Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)

Sign In for Pricing
View Details
Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)
MBS2169403-04 1 mL

Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)

Sign In for Pricing
View Details
Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)
MBS2169403-05 5 mL

Monoclonal Antibody to Ryanodine Receptor 1, Skeletal (RYR1)

Sign In for Pricing
View Details