Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2M5 Peptide - C-terminal region

OR2M5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2M5P

UniProt

A3KFT3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2M5 Rabbit Polyclonal Antibody (orb326314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004690

Preservative

Lyophilized powder

AA Sequence

RRKAFTTCSSHLMVVGMYYGAGLFMYIRPTSDRSPMQDKLVSVFYTILTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1'-Epi 2',2'-difluoro-2'-deoxyuridine 3',5'-dibenzoate
ME16708-01 10 mg

1'-Epi 2',2'-difluoro-2'-deoxyuridine 3',5'-dibenzoate

Sign In for Pricing
View Details
1'-Epi 2',2'-difluoro-2'-deoxyuridine 3',5'-dibenzoate
ME16708-02 25 mg

1'-Epi 2',2'-difluoro-2'-deoxyuridine 3',5'-dibenzoate

Sign In for Pricing
View Details
1'-Epi 2',2'-difluoro-2'-deoxyuridine 3',5'-dibenzoate
ME16708-03 50 mg

1'-Epi 2',2'-difluoro-2'-deoxyuridine 3',5'-dibenzoate

Sign In for Pricing
View Details
1'-Epi 2',2'-difluoro-2'-deoxyuridine 3',5'-dibenzoate
ME16708-04 100 mg

1'-Epi 2',2'-difluoro-2'-deoxyuridine 3',5'-dibenzoate

Sign In for Pricing
View Details
5-Chlorothiophene-2-carboxylic acid hydrazide
sc-233342 1 g

5-Chlorothiophene-2-carboxylic acid hydrazide

Sign In for Pricing
View Details
Lrrc69 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6140905 3x 1.0 µg

Lrrc69 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details