Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2T29 Peptide - C-terminal region

OR2T29 Peptide - C-terminal region

Product Specifications

UniProt

Q8NH02

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2T29 Rabbit Polyclonal Antibody (orb326318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004694

Preservative

Lyophilized powder

AA Sequence

GAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMF1 Antibody, Biotin conjugated
A37038-50UG 50 µg

TMF1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Goat Aurora Kinase B ELISA Kit
MBS097460 Inquire

Goat Aurora Kinase B ELISA Kit

Sign In for Pricing
View Details
Quick Step Bovine Citrulline ELISA KIT
QS0020Bo-01 48 Tests

Quick Step Bovine Citrulline ELISA KIT

Sign In for Pricing
View Details
Quick Step Bovine Citrulline ELISA KIT
QS0020Bo-02 96 Tests

Quick Step Bovine Citrulline ELISA KIT

Sign In for Pricing
View Details
TFF2-set siRNA/shRNA/RNAi Lentivector (Human)
46574091 4x 500 ng

TFF2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Phospho-ERK8 (Thr175+Tyr177) Blocking Peptide
MBS9614561-01 1 mg

Phospho-ERK8 (Thr175+Tyr177) Blocking Peptide

Sign In for Pricing
View Details