Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2T29 Peptide - C-terminal region

OR2T29 Peptide - C-terminal region

Product Specifications

UniProt

Q8NH02

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2T29 Rabbit Polyclonal Antibody (orb326318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004694

Preservative

Lyophilized powder

AA Sequence

GAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MMP3 Antibody Picoband® (Dylight594 Conjugate)
PB9267-Dylight594 100 µg

Anti-MMP3 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
RAD23B Antibody
OACA03541-50UG 50 µg

RAD23B Antibody

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137931-01 0.1 mL

FITC Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137931-02 0.2 mL

FITC Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137931-03 0.5 mL

FITC Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137931-04 1 mL

FITC Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Sign In for Pricing
View Details