Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W1 Peptide - C-terminal region

OR2W1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119162, MGC119163, MGC119165, hs6M1-15

UniProt

Q9Y3N9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2W1 Rabbit Polyclonal Antibody (orb584460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112165

Preservative

Lyophilized powder

AA Sequence

VDTTTVEMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKAMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LFA3 (CD58) Mouse Monoclonal Antibody [Clone ID: B-L28]
AM31246AF-N 200 µg

LFA3 (CD58) Mouse Monoclonal Antibody [Clone ID: B-L28]

Sign In for Pricing
View Details
MDM2 (SMP14), CF405S conjugate, 0.1mg/mL
BNC041721-500 1x 500 µL

MDM2 (SMP14), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBX20 Mouse Monoclonal Antibody [Clone ID: OTI5D4]
CF809303 100 µg

TBX20 Mouse Monoclonal Antibody [Clone ID: OTI5D4]

Sign In for Pricing
View Details
Xylella fastidiosa TaqMan PCR Lyophilized Kits
TM67050L 100 Reactions

Xylella fastidiosa TaqMan PCR Lyophilized Kits

Sign In for Pricing
View Details
Mouse Cbfa2t2 activation kit by CRISPRa
GA200556 1 Kit

Mouse Cbfa2t2 activation kit by CRISPRa

Sign In for Pricing
View Details
ALS2CR4 (TMEM237) (NM_001044385) Human Over-expression Lysate
LC420824 20 µg

ALS2CR4 (TMEM237) (NM_001044385) Human Over-expression Lysate

Sign In for Pricing
View Details