Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W1 Peptide - C-terminal region

OR2W1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119162, MGC119163, MGC119165, hs6M1-15

UniProt

Q9Y3N9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2W1 Rabbit Polyclonal Antibody (orb584460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112165

Preservative

Lyophilized powder

AA Sequence

VDTTTVEMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKAMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NRG3 Antibody
RC-16028-01 50 μL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details
Recombinant NRG3 Antibody
RC-16028-02 100 µL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details
Recombinant NRG3 Antibody
RC-16028-03 1 mL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF405S conjugate, 0.1mg/mL
BNC040242-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant MEN1 Antibody
RC-4078-01 50 μL

Recombinant MEN1 Antibody

Sign In for Pricing
View Details
Recombinant MEN1 Antibody
RC-4078-02 100 µL

Recombinant MEN1 Antibody

Sign In for Pricing
View Details