Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W5 Peptide - middle region

OR2W5 Peptide - middle region

Product Specifications

Product Name Alternative

OR2W5P, OST722

UniProt

A6NFC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2W5 Rabbit Polyclonal Antibody (orb579188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004698

Preservative

Lyophilized powder

AA Sequence

SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS53 3'UTR Luciferase Stable Cell Line
TU028304 1.0 mL

VPS53 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human C-type lectin domain family 4 member D,CLEC4D ELISA KIT
JOT-EK5133Hu-01 96 Well

Human C-type lectin domain family 4 member D,CLEC4D ELISA KIT

Sign In for Pricing
View Details
Human C-type lectin domain family 4 member D,CLEC4D ELISA KIT
JOT-EK5133Hu-02 48 Well

Human C-type lectin domain family 4 member D,CLEC4D ELISA KIT

Sign In for Pricing
View Details
Anti-MSTO1 Antibody Picoband®
A13028-1-carrier-free 100 µg/Vial

Anti-MSTO1 Antibody Picoband®

Sign In for Pricing
View Details
Mouse Anti-Human Total PSA Monoclonal Antibody (Detection)
PA259 1 mg

Mouse Anti-Human Total PSA Monoclonal Antibody (Detection)

Sign In for Pricing
View Details
Lithium acetate dihydrate 5M
40121157-2 500 mL

Lithium acetate dihydrate 5M

Sign In for Pricing
View Details