Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W5 Peptide - middle region

OR2W5 Peptide - middle region

Product Specifications

Product Name Alternative

OR2W5P, OST722

UniProt

A6NFC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2W5 Rabbit Polyclonal Antibody (orb579188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004698

Preservative

Lyophilized powder

AA Sequence

SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound N085-0085
T131165-01 1 mg

Compound N085-0085

Sign In for Pricing
View Details
Compound N085-0085
T131165-02 5 mg

Compound N085-0085

Sign In for Pricing
View Details
Cytokeratin 18 Recombinant Rabbit mAb
BS46283 50 ul

Cytokeratin 18 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)
MBS2097184-01 0.1 mL

Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)
MBS2097184-02 0.2 mL

Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)
MBS2097184-03 0.5 mL

Biotin-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 1 (ADAM1)

Sign In for Pricing
View Details