Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C68 Peptide - N-terminal region

OR6C68 Peptide - N-terminal region

Product Specifications

UniProt

A6NDL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6C68 Rabbit Polyclonal Antibody (orb579200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005519

Preservative

Lyophilized powder

AA Sequence

MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tecloftalam Imide
TRC-T013710-25MG 25 mg

Tecloftalam Imide

Sign In for Pricing
View Details
ASPHD1 (NM_181718) Human Recombinant Protein
TP319226L 1 mg

ASPHD1 (NM_181718) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707527 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CTSC Antibody
KC-47285-01 50 μL

CTSC Antibody

Sign In for Pricing
View Details
CTSC Antibody
KC-47285-02 100 µL

CTSC Antibody

Sign In for Pricing
View Details
CTSC Antibody
KC-47285-03 1 mL

CTSC Antibody

Sign In for Pricing
View Details