Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC3L Peptide - C-terminal region

ORC3L Peptide - C-terminal region

Product Specifications

Product Name Alternative

LAT, LATHEO, ORC3, ORC3L

UniProt

Q9UBD5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ORC3L Rabbit Polyclonal Antibody (orb331176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_862820

Preservative

Lyophilized powder

AA Sequence

VVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF562, NT (ZNF562, Zinc finger protein 562) (Biotin)
MBS6367011-01 0.2 mL

ZNF562, NT (ZNF562, Zinc finger protein 562) (Biotin)

Sign In for Pricing
View Details
ZNF562, NT (ZNF562, Zinc finger protein 562) (Biotin)
MBS6367011-02 5x 0.2 mL

ZNF562, NT (ZNF562, Zinc finger protein 562) (Biotin)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Integration host factor subunit alpha (ihfA)
MBS1399612-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa Integration host factor subunit alpha (ihfA)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Integration host factor subunit alpha (ihfA)
MBS1399612-02 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa Integration host factor subunit alpha (ihfA)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Integration host factor subunit alpha (ihfA)
MBS1399612-03 0.02 mg (Yeast)

Recombinant Xylella fastidiosa Integration host factor subunit alpha (ihfA)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Integration host factor subunit alpha (ihfA)
MBS1399612-04 0.1 mg (Yeast)

Recombinant Xylella fastidiosa Integration host factor subunit alpha (ihfA)

Sign In for Pricing
View Details