Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC3L Peptide - C-terminal region

ORC3L Peptide - C-terminal region

Product Specifications

Product Name Alternative

LAT, LATHEO, ORC3, ORC3L

UniProt

Q9UBD5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ORC3L Rabbit Polyclonal Antibody (orb331176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_862820

Preservative

Lyophilized powder

AA Sequence

VVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRP78 (HSPA5) (NM_005347) Human Tagged Lenti ORF Clone
RC205859L1 10 µg

GRP78 (HSPA5) (NM_005347) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti Human SNX3 Polyclonal
Y054874 100 µL

Anti Human SNX3 Polyclonal

Sign In for Pricing
View Details
Z385B, NT (ZNF385B, ZNF533, Zinc finger protein 385B, Zinc finger protein 533) (PE)
MBS6364445-01 0.2 mL

Z385B, NT (ZNF385B, ZNF533, Zinc finger protein 385B, Zinc finger protein 533) (PE)

Sign In for Pricing
View Details
Z385B, NT (ZNF385B, ZNF533, Zinc finger protein 385B, Zinc finger protein 533) (PE)
MBS6364445-02 5x 0.2 mL

Z385B, NT (ZNF385B, ZNF533, Zinc finger protein 385B, Zinc finger protein 533) (PE)

Sign In for Pricing
View Details
Human GALM AssayLite™ Antibody (RPE Conjugate)
32979-05151 5x 30 µg

Human GALM AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
Retinoblastoma binding protein 1 (ARID4A) (NM_023000) Human Untagged Clone
SC308804 10 µg

Retinoblastoma binding protein 1 (ARID4A) (NM_023000) Human Untagged Clone

Sign In for Pricing
View Details