Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC3L Peptide - N-terminal region

ORC3L Peptide - N-terminal region

Product Specifications

Product Name Alternative

LAT, LATHEO, ORC3, ORC3L

UniProt

Q9UBD5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ORC3L Rabbit Polyclonal Antibody (orb331177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_862820

Preservative

Lyophilized powder

AA Sequence

RFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEA15 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3524R-BF488 100 µL

PEA15 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
3-{2-[Bis (propan-2-yl) amino]ethyl}-2-sulfanyl-3,4-dihydroquinazolin-4-one
FEB95104-01 0.5 g

3-{2-[Bis (propan-2-yl) amino]ethyl}-2-sulfanyl-3,4-dihydroquinazolin-4-one

Sign In for Pricing
View Details
3-{2-[Bis (propan-2-yl) amino]ethyl}-2-sulfanyl-3,4-dihydroquinazolin-4-one
FEB95104-02 5 g

3-{2-[Bis (propan-2-yl) amino]ethyl}-2-sulfanyl-3,4-dihydroquinazolin-4-one

Sign In for Pricing
View Details
Lentiviral mouse Stfa3 shRNA (UAS) - Lentiviral mouse Stfa3 shRNA (UAS) (25)
GTR15171017 1 Vial

Lentiviral mouse Stfa3 shRNA (UAS) - Lentiviral mouse Stfa3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal RNMT Antibody [Biotin]
NBP2-97644B 0.1 mL

Rabbit Polyclonal RNMT Antibody [Biotin]

Sign In for Pricing
View Details
ORNT2 Double Nickase Plasmid (h)
sc-413519-NIC 20 µg

ORNT2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details