Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBP Peptide - C-terminal region

OSBP Peptide - C-terminal region

Product Specifications

Product Name Alternative

OSBP1

UniProt

P22059

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OSBP Rabbit Polyclonal Antibody (orb331090) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002547

Preservative

Lyophilized powder

AA Sequence

ALTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD112/Nectin-2 Protein (His Tag)
PKSM040739 100 µg

Recombinant Mouse CD112/Nectin-2 Protein (His Tag)

Sign In for Pricing
View Details
P27 / KIP1 (KIP1/769), Biotin conjugate, 0.1mg/mL
BNCB0769-500 1x 500 µL

P27 / KIP1 (KIP1/769), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501124 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Propargylamine, Hydrochloride
TRC-P762525-2.5G 2.5 g

Propargylamine, Hydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700141 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
C14orf184 (NM_001080113) Human Over-expression Lysate
LC421584 20 µg

C14orf184 (NM_001080113) Human Over-expression Lysate

Sign In for Pricing
View Details