OSBPL1A Peptide - middle region
OSBPL1A Peptide - middle region
Product Specifications
Product Name Alternative
FLJ10217, ORP-1, ORP1, OSBPL1B
UniProt
Q9BXW6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OSBPL1A Rabbit Polyclonal Antibody (orb325223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_542164
Preservative
Lyophilized powder
AA Sequence
EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![bcl 6 (BCL6) Mouse Monoclonal Antibody [Clone ID: OTI8H3]](https://cdn.genprice.uk/products/937/68dd1b88061270361ea21602/imageurl/ta813918.webp)
TA813918 100 µL
bcl 6 (BCL6) Mouse Monoclonal Antibody [Clone ID: OTI8H3]
Sign In for Pricing
View Details 
BNC740047-500 1x 500 µL
Plasma Cell Marker (LIV3G11, same as 7B18), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Human E-Cadherin Recombinant Rabbit Monoclonal Antibody [SY0287] - BSA and Azide free (Detector)](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea814b2/imageurl/ha723056.webp)
HA723056 100 µL
Human E-Cadherin Recombinant Rabbit Monoclonal Antibody [SY0287] - BSA and Azide free (Detector)
Sign In for Pricing
View Details 
![Mast Cell Tryptase Recombinant Rabbit Monoclonal Antibody [SC68-07]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea8216b/imageurl/et1610-64.webp)
ET1610-64 100 µL
Mast Cell Tryptase Recombinant Rabbit Monoclonal Antibody [SC68-07]
Sign In for Pricing
View Details