Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBPL1A Peptide - middle region

OSBPL1A Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10217, ORP-1, ORP1, OSBPL1B

UniProt

Q9BXW6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OSBPL1A Rabbit Polyclonal Antibody (orb325223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542164

Preservative

Lyophilized powder

AA Sequence

EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Urinary bladder
CR559396 5 µg

Tissue Total RNA, Urinary bladder

Sign In for Pricing
View Details
CDK1 Mouse Monoclonal Antibody [Clone ID: 2G9]
AM06594SU-N 100 µL

CDK1 Mouse Monoclonal Antibody [Clone ID: 2G9]

Sign In for Pricing
View Details
Pivalimidamide Hydrochloride
TRC-P550695-25G 25 g

Pivalimidamide Hydrochloride

Sign In for Pricing
View Details
FNTB (NM_002028) Human Over-expression Lysate
LC400742 20 µg

FNTB (NM_002028) Human Over-expression Lysate

Sign In for Pricing
View Details
Vamp3 Mouse Gene Knockout Kit (CRISPR)
KN518844 1 Kit

Vamp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GST-Tag Mouse Monoclonal Antibody [Clone ID: 4H3]
AM00069PU-N 100 µg

GST-Tag Mouse Monoclonal Antibody [Clone ID: 4H3]

Sign In for Pricing
View Details