Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSCAR Peptide - C-terminal region

OSCAR Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC33613, PIGR3

UniProt

Q8IYS5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OSCAR Rabbit Polyclonal Antibody (orb331212) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570127

Preservative

Lyophilized powder

AA Sequence

VISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQNRAPAGIRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Wilms tumor protein homolog ELISA Kit
orb1660458 96 Tests

Mouse Wilms tumor protein homolog ELISA Kit

Sign In for Pricing
View Details
SAP30BP sgRNA CRISPR Lentivector (Human) (Target 3)
K2088504 1.0 µg DNA

SAP30BP sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Rgl2 shRNA (UAS) - Lentiviral mouse Rgl2 shRNA (UAS, iRFP) (25)
GTR15198686 1 Vial

Lentiviral mouse Rgl2 shRNA (UAS) - Lentiviral mouse Rgl2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Translocon-associated Protein Subunit alpha, NT (SSR1, TRAP-alpha, Signal Sequence Receptor Subunit alpha, SSR-alpha, SSR1, TRAPA, PSEC0262) (Biotin) discontinued
T8266-86-Biotin 200 µL

Translocon-associated Protein Subunit alpha, NT (SSR1, TRAP-alpha, Signal Sequence Receptor Subunit alpha, SSR-alpha, SSR1, TRAPA, PSEC0262) (Biotin) discontinued

Sign In for Pricing
View Details
Arc p34 (ARP2/3 Complex 34kD subunit, Actin-related Protein 2/3 Complex subunit 2) (MaxLight 650) discontinued
A3327-ML650 100 µL

Arc p34 (ARP2/3 Complex 34kD subunit, Actin-related Protein 2/3 Complex subunit 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal CCR9 Antibody (112509) [Janelia Fluor 525]
FAB179JF525 0.1 mL

Mouse Monoclonal CCR9 Antibody (112509) [Janelia Fluor 525]

Sign In for Pricing
View Details