OSTalpha Peptide - middle region
OSTalpha Peptide - middle region
Product Specifications
Product Name Alternative
MGC39807, OSTA, OSTalpha
UniProt
Q86UW1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OSTalpha Rabbit Polyclonal Antibody (orb325819) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689885
Preservative
Lyophilized powder
AA Sequence
LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
JOT-EK1054Ra-01 48 Well
Rat Deoxyribonuclease-2-alpha,DNASE2A ELISA KIT
Sign In for Pricing
View Details JOT-EK1054Ra-02 96 Well
Rat Deoxyribonuclease-2-alpha,DNASE2A ELISA KIT
Sign In for Pricing
View Details 
AC-60-17-15 1 mL
Anti-Rabbit IgG (H+L), Human Serum Adsorbed - 60nm Gold Conjugate
Sign In for Pricing
View Details 042900-ML650 100 µL
TM4SF18, ID (TM4SF18, Transmembrane 4 L6 family member 18) (MaxLight 650) discontinued
Sign In for Pricing
View Details M00978-Biotin 100 µg/Vial
Anti-CLPX Antibody Picoband® (monoclonal, 11C11) (Biotine Conjugate)
Sign In for Pricing
View Details