OSTalpha Peptide - middle region
OSTalpha Peptide - middle region
Product Specifications
Product Name Alternative
MGC39807, OSTA, OSTalpha
UniProt
Q86UW1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OSTalpha Rabbit Polyclonal Antibody (orb325819) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689885
Preservative
Lyophilized powder
AA Sequence
LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9340475-01 48 Well
Human Rho guanine nucleotide exchange factor 16, ARHGEF16 ELISA Kit
Sign In for Pricing
View Details MBS9340475-02 96 Well
Human Rho guanine nucleotide exchange factor 16, ARHGEF16 ELISA Kit
Sign In for Pricing
View Details MBS9340475-03 5x 96 Well
Human Rho guanine nucleotide exchange factor 16, ARHGEF16 ELISA Kit
Sign In for Pricing
View Details MBS9340475-04 10x 96 Well
Human Rho guanine nucleotide exchange factor 16, ARHGEF16 ELISA Kit
Sign In for Pricing
View Details GTR15240336 1 Vial
Lentiviral mouse Hrk shRNA (UAS) - Lentiviral mouse Hrk shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 