Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otc Peptide - C-terminal region

Otc Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI265390, Sf, spf

UniProt

P11725

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Otc Rabbit Polyclonal Antibody (orb578206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032795

Preservative

Lyophilized powder

AA Sequence

YQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIBAC-GGFG-NH2CH2-Dxd
BA2677-1 1 mg

DIBAC-GGFG-NH2CH2-Dxd

Sign In for Pricing
View Details
QuicKey Pro Human CD147 (Extracellular Matrix Metalloproteinase Inducer) ELISA Kit
E-OSEL-H0050-01 24 Tests

QuicKey Pro Human CD147 (Extracellular Matrix Metalloproteinase Inducer) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human CD147 (Extracellular Matrix Metalloproteinase Inducer) ELISA Kit
E-OSEL-H0050-02 48 Tests

QuicKey Pro Human CD147 (Extracellular Matrix Metalloproteinase Inducer) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human CD147 (Extracellular Matrix Metalloproteinase Inducer) ELISA Kit
E-OSEL-H0050-03 96 Tests

QuicKey Pro Human CD147 (Extracellular Matrix Metalloproteinase Inducer) ELISA Kit

Sign In for Pricing
View Details
SAGE1 Polyclonal Antibody
orb1418144 100 µL

SAGE1 Polyclonal Antibody

Sign In for Pricing
View Details
Cyclo (-Gly-Arg-Gly-Glu-Ser-Pro)
4099720.0500 0.5 mg

Cyclo (-Gly-Arg-Gly-Glu-Ser-Pro)

Sign In for Pricing
View Details