Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otc Peptide - C-terminal region

Otc Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI265390, Sf, spf

UniProt

P11725

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Otc Rabbit Polyclonal Antibody (orb578206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032795

Preservative

Lyophilized powder

AA Sequence

YQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OptiClear Sample Kit I
OE-108 1 L

OptiClear Sample Kit I

Sign In for Pricing
View Details
Recombinant Rat Alpha-fetoprotein Protein (His Tag)
PDER100145-01 20 µg

Recombinant Rat Alpha-fetoprotein Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat Alpha-fetoprotein Protein (His Tag)
PDER100145-02 100 µg

Recombinant Rat Alpha-fetoprotein Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat Alpha-fetoprotein Protein (His Tag)
PDER100145-03 500 µg

Recombinant Rat Alpha-fetoprotein Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat Alpha-fetoprotein Protein (His Tag)
PDER100145-04 1 mg

Recombinant Rat Alpha-fetoprotein Protein (His Tag)

Sign In for Pricing
View Details
HSP27 (HSPB1/774), Biotin conjugate, 0.1mg/mL
BNCB0774-100 1x 100 µL

HSP27 (HSPB1/774), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details