Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUB2 Peptide - middle region

OTUB2 Peptide - middle region

Product Specifications

Product Name Alternative

C14orf137, FLJ21916, MGC3102, OTB2, OTU2

UniProt

Q96DC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTUB2 Rabbit Polyclonal Antibody (orb331030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075601

Preservative

Lyophilized powder

AA Sequence

EEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ace activation kit by CRISPRa
GA200020 1 Kit

Mouse Ace activation kit by CRISPRa

Sign In for Pricing
View Details
Frequenin (NCS1) (NM_001128826) Human Over-expression Lysate
LC426991 20 µg

Frequenin (NCS1) (NM_001128826) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS628980 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human RGS13 activation kit by CRISPRa
GA104097 1 Kit

Human RGS13 activation kit by CRISPRa

Sign In for Pricing
View Details
Human CRNKL1 activation kit by CRISPRa
GA109754 1 Kit

Human CRNKL1 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Naphthol-d8
TRC-N368016-10MG 10 mg

2-Naphthol-d8

Sign In for Pricing
View Details